TMA16,C4orf43
  • TMA16,C4orf43

Anti-TMA16 Antibody 100ul

Ref: AN-HPA052688-100ul
Anti-TMA16

Información del producto

Polyclonal Antibody against Human TMA16, Gene description: translation machinery associated 16 homolog, Alternative Gene Names: C4orf43, FLJ11184, Validated applications: ICC, Uniprot ID: Q96EY4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMA16
Gene Description translation machinery associated 16 homolog
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMER
Immunogen KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf43, FLJ11184
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EY4
HTS Code 3002150000
Gene ID 55319
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMA16 Antibody 100ul

Anti-TMA16 Antibody 100ul