MAGEA11,CT1.11
  • MAGEA11,CT1.11

Anti-MAGEA11 Antibody 25ul

Ref: AN-HPA052687-25ul
Anti-MAGEA11

Información del producto

Polyclonal Antibody against Human MAGEA11, Gene description: melanoma antigen family A11, Alternative Gene Names: CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511, Validated applications: ICC, Uniprot ID: P43364, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGEA11
Gene Description melanoma antigen family A11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
Immunogen PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43364
HTS Code 3002150000
Gene ID 4110
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAGEA11 Antibody 25ul

Anti-MAGEA11 Antibody 25ul