DNAH9,DNAH17L
  • DNAH9,DNAH17L

Anti-DNAH9 Antibody 25ul

Ref: AN-HPA052641-25ul
Anti-DNAH9

Información del producto

Polyclonal Antibody against Human DNAH9, Gene description: dynein, axonemal, heavy chain 9, Alternative Gene Names: DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357, Validated applications: IHC, Uniprot ID: Q9NYC9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAH9
Gene Description dynein, axonemal, heavy chain 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL
Immunogen YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNAH17L, Dnahc9, DNAL1, DYH9, HL-20, HL20, KIAA0357
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYC9
HTS Code 3002150000
Gene ID 1770
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAH9 Antibody 25ul

Anti-DNAH9 Antibody 25ul