CENPF,hcp-1
  • CENPF,hcp-1

Anti-CENPF Antibody 100ul

Ref: AN-HPA052382-100ul
Anti-CENPF

Información del producto

Polyclonal Antibody against Human CENPF, Gene description: centromere protein F, 350/400kDa, Alternative Gene Names: hcp-1, Validated applications: ICC, Uniprot ID: P49454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPF
Gene Description centromere protein F, 350/400kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL
Immunogen CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hcp-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49454
HTS Code 3002150000
Gene ID 1063
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CENPF Antibody 100ul

Anti-CENPF Antibody 100ul