ABCC5,EST277145
  • ABCC5,EST277145

Anti-ABCC5 Antibody 25ul

Ref: AN-HPA052295-25ul
Anti-ABCC5

Información del producto

Polyclonal Antibody against Human ABCC5, Gene description: ATP-binding cassette, sub-family C (CFTR/MRP), member 5, Alternative Gene Names: EST277145, MOAT-C, MRP5, SMRP, Validated applications: IHC, Uniprot ID: O15440, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ABCC5
Gene Description ATP-binding cassette, sub-family C (CFTR/MRP), member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
Immunogen SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EST277145, MOAT-C, MRP5, SMRP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15440
HTS Code 3002150000
Gene ID 10057
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ABCC5 Antibody 25ul

Anti-ABCC5 Antibody 25ul