RAD50,hRad50,RAD50-2
  • RAD50,hRad50,RAD50-2

Anti-RAD50 Antibody 25ul

Ref: AN-HPA052291-25ul
Anti-RAD50

Información del producto

Polyclonal Antibody against Human RAD50, Gene description: RAD50 homolog (S. cerevisiae), Alternative Gene Names: hRad50, RAD50-2, Validated applications: ICC, IHC, Uniprot ID: Q92878, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RAD50
Gene Description RAD50 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV
Immunogen ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hRad50, RAD50-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92878
HTS Code 3002150000
Gene ID 10111
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAD50 Antibody 25ul

Anti-RAD50 Antibody 25ul