OIP5,CT86
  • OIP5,CT86

Anti-OIP5 Antibody 100ul

Ref: AN-HPA052271-100ul
Anti-OIP5

Información del producto

Polyclonal Antibody against Human OIP5, Gene description: Opa interacting protein 5, Alternative Gene Names: CT86, hMIS18beta, MIS18B, Validated applications: ICC, IHC, WB, Uniprot ID: O43482, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OIP5
Gene Description Opa interacting protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
Immunogen CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT86, hMIS18beta, MIS18B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43482
HTS Code 3002150000
Gene ID 11339
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OIP5 Antibody 100ul

Anti-OIP5 Antibody 100ul