ZNF639,ANC-2H01
  • ZNF639,ANC-2H01

Anti-ZNF639 Antibody 100ul

Ref: AN-HPA052163-100ul
Anti-ZNF639

Información del producto

Polyclonal Antibody against Human ZNF639, Gene description: zinc finger protein 639, Alternative Gene Names: ANC-2H01, ZASC1, Validated applications: IHC, Uniprot ID: Q9UID6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF639
Gene Description zinc finger protein 639
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVL
Immunogen KRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ANC-2H01, ZASC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UID6
HTS Code 3002150000
Gene ID 51193
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF639 Antibody 100ul

Anti-ZNF639 Antibody 100ul