CABLES2,C20orf150
  • CABLES2,C20orf150

Anti-CABLES2 Antibody 100ul

Ref: AN-HPA052138-100ul
Anti-CABLES2

Información del producto

Polyclonal Antibody against Human CABLES2, Gene description: Cdk5 and Abl enzyme substrate 2, Alternative Gene Names: C20orf150, dJ908M14.2, ik3-2, Validated applications: ICC, Uniprot ID: Q9BTV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CABLES2
Gene Description Cdk5 and Abl enzyme substrate 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Immunogen AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf150, dJ908M14.2, ik3-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTV7
HTS Code 3002150000
Gene ID 81928
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CABLES2 Antibody 100ul

Anti-CABLES2 Antibody 100ul