TTC30A,FLJ13946
  • TTC30A,FLJ13946

Anti-TTC30A Antibody 25ul

Ref: AN-HPA052100-25ul
Anti-TTC30A

Información del producto

Polyclonal Antibody against Human TTC30A, Gene description: tetratricopeptide repeat domain 30A, Alternative Gene Names: FLJ13946, IFT70A, Validated applications: IHC, Uniprot ID: Q86WT1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TTC30A
Gene Description tetratricopeptide repeat domain 30A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFL
Immunogen ETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13946, IFT70A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86WT1
HTS Code 3002150000
Gene ID 92104
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC30A Antibody 25ul

Anti-TTC30A Antibody 25ul