HDAC3,HD3,RPD3
  • HDAC3,HD3,RPD3

Anti-HDAC3 Antibody 100ul

Ref: AN-HPA052052-100ul
Anti-HDAC3

Información del producto

Polyclonal Antibody against Human HDAC3, Gene description: histone deacetylase 3, Alternative Gene Names: HD3, RPD3, RPD3-2, Validated applications: ICC, IHC, WB, Uniprot ID: O15379, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HDAC3
Gene Description histone deacetylase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVE
Immunogen QYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HD3, RPD3, RPD3-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15379
HTS Code 3002150000
Gene ID 8841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HDAC3 Antibody 100ul

Anti-HDAC3 Antibody 100ul