ZNF354A,EZNF,HKL1
  • ZNF354A,EZNF,HKL1

Anti-ZNF354A Antibody 100ul

Ref: AN-HPA052043-100ul
Anti-ZNF354A

Información del producto

Polyclonal Antibody against Human ZNF354A, Gene description: zinc finger protein 354A, Alternative Gene Names: EZNF, HKL1, KID-1, KID1, TCF17, Validated applications: ICC, IHC, Uniprot ID: O60765, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF354A
Gene Description zinc finger protein 354A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Immunogen TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EZNF, HKL1, KID-1, KID1, TCF17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60765
HTS Code 3002150000
Gene ID 6940
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF354A Antibody 100ul

Anti-ZNF354A Antibody 100ul