MUC21,bCX31G15.2
  • MUC21,bCX31G15.2

Anti-MUC21 Antibody 25ul

Ref: AN-HPA052028-25ul
Anti-MUC21

Información del producto

Polyclonal Antibody against Human MUC21, Gene description: mucin 21, cell surface associated, Alternative Gene Names: bCX31G15.2, C6orf205, Validated applications: IHC, Uniprot ID: Q5SSG8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MUC21
Gene Description mucin 21, cell surface associated
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS
Immunogen CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bCX31G15.2, C6orf205
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SSG8
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MUC21 Antibody 25ul

Anti-MUC21 Antibody 25ul