PNLDC1,dJ195P10.2
  • PNLDC1,dJ195P10.2

Anti-PNLDC1 Antibody 100ul

Ref: AN-HPA052026-100ul
Anti-PNLDC1

Información del producto

Polyclonal Antibody against Human PNLDC1, Gene description: poly(A)-specific ribonuclease (PARN)-like domain containing 1, Alternative Gene Names: dJ195P10.2, FLJ40240, Validated applications: IHC, Uniprot ID: Q8NA58, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PNLDC1
Gene Description poly(A)-specific ribonuclease (PARN)-like domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
Immunogen VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ195P10.2, FLJ40240
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NA58
HTS Code 3002150000
Gene ID 154197
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNLDC1 Antibody 100ul

Anti-PNLDC1 Antibody 100ul