S100Z,Gm625
  • S100Z,Gm625

Anti-S100Z Antibody 100ul

Ref: AN-HPA051929-100ul
Anti-S100Z

Información del producto

Polyclonal Antibody against Human S100Z, Gene description: S100 calcium binding protein Z, Alternative Gene Names: Gm625, S100-zeta, Validated applications: IHC, Uniprot ID: Q8WXG8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name S100Z
Gene Description S100 calcium binding protein Z
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MPTQLEMAMDTMIRIFHRYSGKARKRFKLS
Immunogen MPTQLEMAMDTMIRIFHRYSGKARKRFKLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Gm625, S100-zeta
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WXG8
HTS Code 3002150000
Gene ID 170591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-S100Z Antibody 100ul

Anti-S100Z Antibody 100ul