FKBP1A,FKBP-12
  • FKBP1A,FKBP-12

Anti-FKBP1A Antibody 100ul

Ref: AN-HPA051798-100ul
Anti-FKBP1A

Información del producto

Polyclonal Antibody against Human FKBP1A, Gene description: FK506 binding protein 1A, 12kDa, Alternative Gene Names: FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PPIASE, Validated applications: IHC, WB, Uniprot ID: P62942, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FKBP1A
Gene Description FK506 binding protein 1A, 12kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
Immunogen MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PPIASE
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62942
HTS Code 3002150000
Gene ID 2280
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FKBP1A Antibody 100ul

Anti-FKBP1A Antibody 100ul