SOX13,ICA12
  • SOX13,ICA12

Anti-SOX13 Antibody 100ul

Ref: AN-HPA051790-100ul
Anti-SOX13

Información del producto

Polyclonal Antibody against Human SOX13, Gene description: SRY (sex determining region Y)-box 13, Alternative Gene Names: ICA12, MGC117216, Sox-13, Validated applications: ICC, Uniprot ID: Q9UN79, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SOX13
Gene Description SRY (sex determining region Y)-box 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Immunogen DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ICA12, MGC117216, Sox-13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UN79
HTS Code 3002150000
Gene ID 9580
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SOX13 Antibody 100ul

Anti-SOX13 Antibody 100ul