ACBD4,FLJ13322
  • ACBD4,FLJ13322

Anti-ACBD4 Antibody 100ul

Ref: AN-HPA051772-100ul
Anti-ACBD4

Información del producto

Polyclonal Antibody against Human ACBD4, Gene description: acyl-CoA binding domain containing 4, Alternative Gene Names: FLJ13322, Validated applications: ICC, IHC, Uniprot ID: Q8NC06, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ACBD4
Gene Description acyl-CoA binding domain containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPA
Immunogen SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13322
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NC06
HTS Code 3002150000
Gene ID 79777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACBD4 Antibody 100ul

Anti-ACBD4 Antibody 100ul