NOM1,C7orf3
  • NOM1,C7orf3

Anti-NOM1 Antibody 25ul

Ref: AN-HPA051624-25ul
Anti-NOM1

Información del producto

Polyclonal Antibody against Human NOM1, Gene description: nucleolar protein with MIF4G domain 1, Alternative Gene Names: C7orf3, PPP1R113, SGD1, Validated applications: ICC, WB, Uniprot ID: Q5C9Z4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NOM1
Gene Description nucleolar protein with MIF4G domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence VSWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTHLQKQLVGTVSSKILELARKQRMNTDIRRNIFCTIMTSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQEKTYNPFYAFLASKFCEYERRFQMTFQ
Immunogen VSWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTHLQKQLVGTVSSKILELARKQRMNTDIRRNIFCTIMTSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQEKTYNPFYAFLASKFCEYERRFQMTFQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf3, PPP1R113, SGD1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5C9Z4
HTS Code 3002150000
Gene ID 64434
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOM1 Antibody 25ul

Anti-NOM1 Antibody 25ul