NSMCE2,C8orf36
  • NSMCE2,C8orf36

Anti-NSMCE2 Antibody 100ul

Ref: AN-HPA051614-100ul
Anti-NSMCE2

Información del producto

Polyclonal Antibody against Human NSMCE2, Gene description: NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase, Alternative Gene Names: C8orf36, FLJ32440, MMS21, NSE2, ZMIZ7, Validated applications: ICC, Uniprot ID: Q96MF7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NSMCE2
Gene Description NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Immunogen SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf36, FLJ32440, MMS21, NSE2, ZMIZ7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96MF7
HTS Code 3002150000
Gene ID 286053
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NSMCE2 Antibody 100ul

Anti-NSMCE2 Antibody 100ul