TUSC1,TSG-9
  • TUSC1,TSG-9

Anti-TUSC1 Antibody 25ul

Ref: AN-HPA051426-25ul
Anti-TUSC1

Información del producto

Polyclonal Antibody against Human TUSC1, Gene description: tumor suppressor candidate 1, Alternative Gene Names: TSG-9, Validated applications: ICC, IHC, Uniprot ID: Q2TAM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TUSC1
Gene Description tumor suppressor candidate 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
Immunogen TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TSG-9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2TAM9
HTS Code 3002150000
Gene ID 286319
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TUSC1 Antibody 25ul

Anti-TUSC1 Antibody 25ul