NDUFB2,AGGG,CI-AGGG
  • NDUFB2,AGGG,CI-AGGG

Anti-NDUFB2 Antibody 25ul

Ref: AN-HPA051377-25ul
Anti-NDUFB2

Información del producto

Polyclonal Antibody against Human NDUFB2, Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa, Alternative Gene Names: AGGG, CI-AGGG, Validated applications: IHC, Uniprot ID: O95178, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDUFB2
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Immunogen QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AGGG, CI-AGGG
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95178
HTS Code 3002150000
Gene ID 4708
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFB2 Antibody 25ul

Anti-NDUFB2 Antibody 25ul