MTMR12,3-PAP,3PAP
  • MTMR12,3-PAP,3PAP

Anti-MTMR12 Antibody 25ul

Ref: AN-HPA051333-25ul
Anti-MTMR12

Información del producto

Polyclonal Antibody against Human MTMR12, Gene description: myotubularin related protein 12, Alternative Gene Names: 3-PAP, 3PAP, FLJ20476, KIAA1682, PIP3AP, Validated applications: IHC, Uniprot ID: Q9C0I1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MTMR12
Gene Description myotubularin related protein 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE
Immunogen RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 3-PAP, 3PAP, FLJ20476, KIAA1682, PIP3AP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0I1
HTS Code 3002150000
Gene ID 54545
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MTMR12 Antibody 25ul

Anti-MTMR12 Antibody 25ul