MRPL4,CGI-28
  • MRPL4,CGI-28

Anti-MRPL4 Antibody 100ul

Ref: AN-HPA051261-100ul
Anti-MRPL4

Información del producto

Polyclonal Antibody against Human MRPL4, Gene description: mitochondrial ribosomal protein L4, Alternative Gene Names: CGI-28, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BYD3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL4
Gene Description mitochondrial ribosomal protein L4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
Immunogen MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYD3
HTS Code 3002150000
Gene ID 51073
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL4 Antibody 100ul

Anti-MRPL4 Antibody 100ul