MIF4GD,AD023
  • MIF4GD,AD023

Anti-MIF4GD Antibody 25ul

Ref: AN-HPA051222-25ul
Anti-MIF4GD

Información del producto

Polyclonal Antibody against Human MIF4GD, Gene description: MIF4G domain containing, Alternative Gene Names: AD023, MGC45027, MIFD, Validated applications: ICC, IHC, WB, Uniprot ID: A9UHW6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MIF4GD
Gene Description MIF4G domain containing
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Immunogen GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AD023, MGC45027, MIFD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A9UHW6
HTS Code 3002150000
Gene ID 57409
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MIF4GD Antibody 25ul

Anti-MIF4GD Antibody 25ul