SECTM1,K12
  • SECTM1,K12

Anti-SECTM1 Antibody 25ul

Ref: AN-HPA051214-25ul
Anti-SECTM1

Información del producto

Polyclonal Antibody against Human SECTM1, Gene description: secreted and transmembrane 1, Alternative Gene Names: K12, Validated applications: IHC, Uniprot ID: Q8WVN6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SECTM1
Gene Description secreted and transmembrane 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAAD
Immunogen CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names K12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVN6
HTS Code 3002150000
Gene ID 6398
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SECTM1 Antibody 25ul

Anti-SECTM1 Antibody 25ul