TRPC4AP,C20orf188
  • TRPC4AP,C20orf188

Anti-TRPC4AP Antibody 100ul

Ref: AN-HPA051197-100ul
Anti-TRPC4AP

Información del producto

Polyclonal Antibody against Human TRPC4AP, Gene description: transient receptor potential cation channel, subfamily C, member 4 associated protein, Alternative Gene Names: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP, Validated applications: IHC, Uniprot ID: Q8TEL6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TRPC4AP
Gene Description transient receptor potential cation channel, subfamily C, member 4 associated protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Immunogen LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TEL6
HTS Code 3002150000
Gene ID 26133
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRPC4AP Antibody 100ul

Anti-TRPC4AP Antibody 100ul