CORO1A,coronin-1
  • CORO1A,coronin-1

Anti-CORO1A Antibody 25ul

Ref: AN-HPA051132-25ul
Anti-CORO1A

Información del producto

Polyclonal Antibody against Human CORO1A, Gene description: coronin, actin binding protein, 1A, Alternative Gene Names: coronin-1, HCORO1, p57, Validated applications: ICC, IHC, WB, Uniprot ID: P31146, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CORO1A
Gene Description coronin, actin binding protein, 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA
Immunogen RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names coronin-1, HCORO1, p57
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P31146
HTS Code 3002150000
Gene ID 11151
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CORO1A Antibody 25ul

Anti-CORO1A Antibody 25ul