C1orf204,FLJ39187
  • C1orf204,FLJ39187

Anti-C1orf204 Antibody 100ul

Ref: AN-HPA051028-100ul
Anti-C1orf204

Información del producto

Polyclonal Antibody against Human C1orf204, Gene description: chromosome 1 open reading frame 204, Alternative Gene Names: FLJ39187, Validated applications: ICC, Uniprot ID: Q5VU13, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1orf204
Gene Description chromosome 1 open reading frame 204
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Immunogen SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ39187
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VU13
HTS Code 3002150000
Gene ID 284677
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf204 Antibody 100ul

Anti-C1orf204 Antibody 100ul