EEF1D,EF-1D,FLJ20897
  • EEF1D,EF-1D,FLJ20897

Anti-EEF1D Antibody 25ul

Ref: AN-HPA051002-25ul
Anti-EEF1D

Información del producto

Polyclonal Antibody against Human EEF1D, Gene description: eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein), Alternative Gene Names: EF-1D, FLJ20897, Validated applications: ICC, WB, Uniprot ID: P29692, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EEF1D
Gene Description eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
Immunogen PRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPPALAPWGLCTHGNQVACHHVTWGIWVNKSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EF-1D, FLJ20897
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P29692
HTS Code 3002150000
Gene ID 1936
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EEF1D Antibody 25ul

Anti-EEF1D Antibody 25ul