ATAT1,C6orf134
  • ATAT1,C6orf134

Anti-ATAT1 Antibody 25ul

Ref: AN-HPA050999-25ul
Anti-ATAT1

Información del producto

Polyclonal Antibody against Human ATAT1, Gene description: alpha tubulin acetyltransferase 1, Alternative Gene Names: C6orf134, Em:AB023049.7, FLJ13158, MEC17, Validated applications: ICC, IHC, Uniprot ID: Q5SQI0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ATAT1
Gene Description alpha tubulin acetyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR
Immunogen QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf134, Em:AB023049.7, FLJ13158, MEC17
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SQI0
HTS Code 3002150000
Gene ID 79969
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ATAT1 Antibody 25ul

Anti-ATAT1 Antibody 25ul