TNFRSF10A,Apo2
  • TNFRSF10A,Apo2

Anti-TNFRSF10A Antibody 100ul

Ref: AN-HPA050958-100ul
Anti-TNFRSF10A

Información del producto

Polyclonal Antibody against Human TNFRSF10A, Gene description: tumor necrosis factor receptor superfamily, member 10a, Alternative Gene Names: Apo2, CD261, DR4, TRAILR-1, Validated applications: ICC, Uniprot ID: O00220, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNFRSF10A
Gene Description tumor necrosis factor receptor superfamily, member 10a
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
Immunogen ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Apo2, CD261, DR4, TRAILR-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00220
HTS Code 3002150000
Gene ID 8797
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNFRSF10A Antibody 100ul

Anti-TNFRSF10A Antibody 100ul