ZC2HC1C,C14orf140
  • ZC2HC1C,C14orf140

Anti-ZC2HC1C Antibody 100ul

Ref: AN-HPA050928-100ul
Anti-ZC2HC1C

Información del producto

Polyclonal Antibody against Human ZC2HC1C, Gene description: zinc finger, C2HC-type containing 1C, Alternative Gene Names: C14orf140, FAM164C, Validated applications: ICC, IHC, WB, Uniprot ID: Q53FD0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZC2HC1C
Gene Description zinc finger, C2HC-type containing 1C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence ENENGELQKIILPRSRVKGNKSNTMYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSVPFQFSDYRIQRLKRERLVASNNKIRDP
Immunogen ENENGELQKIILPRSRVKGNKSNTMYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSVPFQFSDYRIQRLKRERLVASNNKIRDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf140, FAM164C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53FD0
HTS Code 3002150000
Gene ID 79696
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZC2HC1C Antibody 100ul

Anti-ZC2HC1C Antibody 100ul