SLC25A23,APC2
  • SLC25A23,APC2

Anti-SLC25A23 Antibody 25ul

Ref: AN-HPA050883-25ul
Anti-SLC25A23

Información del producto

Polyclonal Antibody against Human SLC25A23, Gene description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Alternative Gene Names: APC2, FLJ30339, MGC2615, Validated applications: IHC, WB, Uniprot ID: Q9BV35, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC25A23
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
Immunogen GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APC2, FLJ30339, MGC2615
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BV35
HTS Code 3002150000
Gene ID 79085
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC25A23 Antibody 25ul

Anti-SLC25A23 Antibody 25ul