ISLR,HsT17563
  • ISLR,HsT17563

Anti-ISLR Antibody 25ul

Ref: AN-HPA050811-25ul
Anti-ISLR

Información del producto

Polyclonal Antibody against Human ISLR, Gene description: immunoglobulin superfamily containing leucine-rich repeat, Alternative Gene Names: HsT17563, Validated applications: IHC, Uniprot ID: O14498, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ISLR
Gene Description immunoglobulin superfamily containing leucine-rich repeat
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
Immunogen LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT17563
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14498
HTS Code 3002150000
Gene ID 3671
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ISLR Antibody 25ul

Anti-ISLR Antibody 25ul