PBK,CT84,FLJ14385
  • PBK,CT84,FLJ14385

Anti-PBK Antibody 25ul

Ref: AN-HPA050656-25ul
Anti-PBK

Información del producto

Polyclonal Antibody against Human PBK, Gene description: PDZ binding kinase, Alternative Gene Names: CT84, FLJ14385, Nori-3, SPK, TOPK, Validated applications: IHC, WB, Uniprot ID: Q96KB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PBK
Gene Description PDZ binding kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQD
Immunogen ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT84, FLJ14385, Nori-3, SPK, TOPK
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KB5
HTS Code 3002150000
Gene ID 55872
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PBK Antibody 25ul

Anti-PBK Antibody 25ul