POU1F1,GHF-1,PIT1
  • POU1F1,GHF-1,PIT1

Anti-POU1F1 Antibody 25ul

Ref: AN-HPA050624-25ul
Anti-POU1F1

Información del producto

Polyclonal Antibody against Human POU1F1, Gene description: POU class 1 homeobox 1, Alternative Gene Names: GHF-1, PIT1, POU1F1a, Validated applications: IHC, Uniprot ID: P28069, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POU1F1
Gene Description POU class 1 homeobox 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
Immunogen FPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GHF-1, PIT1, POU1F1a
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28069
HTS Code 3002150000
Gene ID 5449
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POU1F1 Antibody 25ul

Anti-POU1F1 Antibody 25ul