ZNF292,bA393I2.3
  • ZNF292,bA393I2.3

Anti-ZNF292 Antibody 25ul

Ref: AN-HPA050618-25ul
Anti-ZNF292

Información del producto

Polyclonal Antibody against Human ZNF292, Gene description: zinc finger protein 292, Alternative Gene Names: bA393I2.3, KIAA0530, ZFP292, Zn-15, Zn-16, Validated applications: IHC, Uniprot ID: O60281, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF292
Gene Description zinc finger protein 292
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPAC
Immunogen NSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPAC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA393I2.3, KIAA0530, ZFP292, Zn-15, Zn-16
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60281
HTS Code 3002150000
Gene ID 23036
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF292 Antibody 25ul

Anti-ZNF292 Antibody 25ul