SLC17A1,NAPI-1,NPT1
  • SLC17A1,NAPI-1,NPT1

Anti-SLC17A1 Antibody 100ul

Ref: AN-HPA050513-100ul
Anti-SLC17A1

Información del producto

Polyclonal Antibody against Human SLC17A1, Gene description: solute carrier family 17 (organic anion transporter), member 1, Alternative Gene Names: NAPI-1, NPT1, Validated applications: ICC, Uniprot ID: Q14916, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC17A1
Gene Description solute carrier family 17 (organic anion transporter), member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Immunogen CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NAPI-1, NPT1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14916
HTS Code 3002150000
Gene ID 6568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC17A1 Antibody 100ul

Anti-SLC17A1 Antibody 100ul