METTL1,C12orf1,TRM8
  • METTL1,C12orf1,TRM8

Anti-METTL1 Antibody 100ul

Ref: AN-HPA050450-100ul
Anti-METTL1

Información del producto

Polyclonal Antibody against Human METTL1, Gene description: methyltransferase like 1, Alternative Gene Names: C12orf1, TRM8, TRMT8, Validated applications: ICC, WB, Uniprot ID: Q9UBP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name METTL1
Gene Description methyltransferase like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Immunogen NQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf1, TRM8, TRMT8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBP6
HTS Code 3002150000
Gene ID 4234
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-METTL1 Antibody 100ul

Anti-METTL1 Antibody 100ul