TBRG4,Cpr2,FASTKD4
  • TBRG4,Cpr2,FASTKD4

Anti-TBRG4 Antibody 25ul

Ref: AN-HPA050430-25ul
Anti-TBRG4

Información del producto

Polyclonal Antibody against Human TBRG4, Gene description: transforming growth factor beta regulator 4, Alternative Gene Names: Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948, Validated applications: ICC, WB, Uniprot ID: Q969Z0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TBRG4
Gene Description transforming growth factor beta regulator 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG
Immunogen FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cpr2, FASTKD4, H_TD2522F11.8, KIAA0948
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969Z0
HTS Code 3002150000
Gene ID 9238
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TBRG4 Antibody 25ul

Anti-TBRG4 Antibody 25ul