MRPS18C,CGI-134
  • MRPS18C,CGI-134

Anti-MRPS18C Antibody 25ul

Ref: AN-HPA050404-25ul
Anti-MRPS18C

Información del producto

Polyclonal Antibody against Human MRPS18C, Gene description: mitochondrial ribosomal protein S18C, Alternative Gene Names: CGI-134, FLJ11146, FLJ22967, MRPS18-1, Validated applications: IHC, Uniprot ID: Q9Y3D5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPS18C
Gene Description mitochondrial ribosomal protein S18C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Immunogen HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-134, FLJ11146, FLJ22967, MRPS18-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3D5
HTS Code 3002150000
Gene ID 51023
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS18C Antibody 25ul

Anti-MRPS18C Antibody 25ul