CD226,DNAM-1,DNAM1
  • CD226,DNAM-1,DNAM1

Anti-CD226 Antibody 25ul

Ref: AN-HPA050348-25ul
Anti-CD226

Información del producto

Polyclonal Antibody against Human CD226, Gene description: CD226 molecule, Alternative Gene Names: DNAM-1, DNAM1, PTA1, TLiSA1, Validated applications: ICC, Uniprot ID: Q15762, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CD226
Gene Description CD226 molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA
Immunogen EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DNAM-1, DNAM1, PTA1, TLiSA1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15762
HTS Code 3002150000
Gene ID 10666
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CD226 Antibody 25ul

Anti-CD226 Antibody 25ul