TMED5,CGI-100
  • TMED5,CGI-100

Anti-TMED5 Antibody 100ul

Ref: AN-HPA050289-100ul
Anti-TMED5

Información del producto

Polyclonal Antibody against Human TMED5, Gene description: transmembrane emp24 protein transport domain containing 5, Alternative Gene Names: CGI-100, Validated applications: IHC, WB, Uniprot ID: Q9Y3A6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMED5
Gene Description transmembrane emp24 protein transport domain containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL
Immunogen FELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-100
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3A6
HTS Code 3002150000
Gene ID 50999
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMED5 Antibody 100ul

Anti-TMED5 Antibody 100ul