MORC4,FLJ11565,ZCW4
  • MORC4,FLJ11565,ZCW4

Anti-MORC4 Antibody 25ul

Ref: AN-HPA050250-25ul
Anti-MORC4

Información del producto

Polyclonal Antibody against Human MORC4, Gene description: MORC family CW-type zinc finger 4, Alternative Gene Names: FLJ11565, ZCW4, ZCWCC2, Validated applications: ICC, Uniprot ID: Q8TE76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MORC4
Gene Description MORC family CW-type zinc finger 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ
Immunogen SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11565, ZCW4, ZCWCC2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TE76
HTS Code 3002150000
Gene ID 79710
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MORC4 Antibody 25ul

Anti-MORC4 Antibody 25ul