NCOA5,bA465L10.6,CIA
  • NCOA5,bA465L10.6,CIA

Anti-NCOA5 Antibody 25ul

Ref: AN-HPA050231-25ul
Anti-NCOA5

Información del producto

Polyclonal Antibody against Human NCOA5, Gene description: nuclear receptor coactivator 5, Alternative Gene Names: bA465L10.6, CIA, Validated applications: ICC, IHC, WB, Uniprot ID: Q9HCD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NCOA5
Gene Description nuclear receptor coactivator 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Immunogen NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA465L10.6, CIA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCD5
HTS Code 3002150000
Gene ID 57727
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NCOA5 Antibody 25ul

Anti-NCOA5 Antibody 25ul