ALDH1L1,10-fTHF
  • ALDH1L1,10-fTHF

Anti-ALDH1L1 Antibody 25ul

Ref: AN-HPA050139-25ul
Anti-ALDH1L1

Información del producto

Polyclonal Antibody against Human ALDH1L1, Gene description: aldehyde dehydrogenase 1 family, member L1, Alternative Gene Names: 10-fTHF, FTHFD, Validated applications: ICC, IHC, Uniprot ID: O75891, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ALDH1L1
Gene Description aldehyde dehydrogenase 1 family, member L1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP
Immunogen EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 10-fTHF, FTHFD
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75891
HTS Code 3002150000
Gene ID 10840
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ALDH1L1 Antibody 25ul

Anti-ALDH1L1 Antibody 25ul