MRPS16,CGI-132
  • MRPS16,CGI-132

Anti-MRPS16 Antibody 100ul

Ref: AN-HPA050081-100ul
Anti-MRPS16

Información del producto

Polyclonal Antibody against Human MRPS16, Gene description: mitochondrial ribosomal protein S16, Alternative Gene Names: CGI-132, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3D3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS16
Gene Description mitochondrial ribosomal protein S16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
Immunogen ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-132
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3D3
HTS Code 3002150000
Gene ID 51021
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS16 Antibody 100ul

Anti-MRPS16 Antibody 100ul