EDDM3A,FAM12A
  • EDDM3A,FAM12A

Anti-EDDM3A Antibody 100ul

Ref: AN-HPA049952-100ul
Anti-EDDM3A

Información del producto

Polyclonal Antibody against Human EDDM3A, Gene description: epididymal protein 3A, Alternative Gene Names: FAM12A, HE3-ALPHA, Validated applications: IHC, Uniprot ID: Q14507, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EDDM3A
Gene Description epididymal protein 3A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
Immunogen KEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM12A, HE3-ALPHA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14507
HTS Code 3002150000
Gene ID 10876
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EDDM3A Antibody 100ul

Anti-EDDM3A Antibody 100ul