SRSF2,PR264,SC-35
  • SRSF2,PR264,SC-35

Anti-SRSF2 Antibody 100ul

Ref: AN-HPA049905-100ul
Anti-SRSF2

Información del producto

Polyclonal Antibody against Human SRSF2, Gene description: serine/arginine-rich splicing factor 2, Alternative Gene Names: PR264, SC-35, SC35, SFRS2, SFRS2A, Validated applications: ICC, IHC, Uniprot ID: Q01130, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SRSF2
Gene Description serine/arginine-rich splicing factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
Immunogen LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PR264, SC-35, SC35, SFRS2, SFRS2A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01130
HTS Code 3002150000
Gene ID 6427
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SRSF2 Antibody 100ul

Anti-SRSF2 Antibody 100ul